SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG16590_internal:A_BomoMSG_c25551_g2_i3
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
heparanase-like_protein_[Bombyx_mori]
Ontology
GO:0004566 F beta-glucuronidase activity
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005975 P carbohydrate metabolic process
GO:0006027 P glycosaminoglycan catabolic process
GO:0006029 P proteoglycan metabolic process
GO:0007155 P cell adhesion
GO:0007160 P cell-matrix adhesion
GO:0010575 P positive regulation of vascular endothelial growth factor production
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0030194 P positive regulation of blood coagulation
GO:0030200 P heparan sulfate proteoglycan catabolic process
GO:0030305 F heparanase activity
GO:0033690 P positive regulation of osteoblast proliferation
GO:0042060 P wound healing
GO:0043202 C lysosomal lumen
GO:0043231 C intracellular membrane-bounded organelle
GO:0045121 C membrane raft
GO:0045545 F syndecan binding
GO:0046983 F protein dimerization activity
GO:0051797 P regulation of hair follicle development
GO:0051798 P positive regulation of hair follicle development
GO:0051897 P positive regulation of protein kinase B signaling
GO:0060055 P angiogenesis involved in wound healing
GO:0061042 P vascular wound healing
RNA-seq EntryA_BomoMSG_c25551_g2_i3
Sequence
(Amino Acid)
CSSDLFEKLRKLLNHNGYRHSLIVGPDTTRPQPHRPECLKYMIEFLGNGSHYINVRSWHQ
YYLNSKTAKLEDFWNPETFDLLRQQIETMQNQTKKYKNIPMWLSETSSSYGGGAPGLSNT
YAGSPLWIDKLGLSAKYNISTVIRQSFIGGYYSLVDENLKPLPDWW
(54 a.a.)

- SilkBase 1999-2023 -