SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG16491_5prime_partial:A_BomoMSG_c25518_g1_i2
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)
uncharacterized_protein_LOC101747197_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000414 P regulation of histone H3-K36 methylation
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0001702 P gastrulation with mouth forming second
GO:0003682 F chromatin binding
GO:0003712 F transcription coregulator activity
GO:0003714 F transcription corepressor activity
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0008168 F methyltransferase activity
GO:0008270 F zinc ion binding
GO:0010452 P histone H3-K36 methylation
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0030331 F estrogen receptor binding
GO:0032259 P methylation
GO:0033135 P regulation of peptidyl-serine phosphorylation
GO:0034770 P histone H4-K20 methylation
GO:0035097 C histone methyltransferase complex
GO:0042054 F histone methyltransferase activity
GO:0042799 F histone methyltransferase activity (H4-K20 specific)
GO:0042974 F retinoic acid receptor binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0046965 F retinoid X receptor binding
GO:0046966 F thyroid hormone receptor binding
GO:0046975 F histone methyltransferase activity (H3-K36 specific)
GO:0050681 F androgen receptor binding
GO:1903025 P regulation of RNA polymerase II regulatory region sequence-specific DNA binding
RNA-seq EntryA_BomoMSG_c25518_g1_i2
Sequence
(Amino Acid)
GWKLDDPELSLTQCECDPTNEDPCGPYSQCLNRMLLTECGPTCRTGERCNNRAFEKRQYP
KLVPYRTPQRGWGLKTLEDIKAGQFVIEYVGELIDEEEFRRRMRRKHEIRDENFYFLTLD
KERMIDAGPKGNLARFMNHCCEPNCETQKWTVLGDIRVGLFAINDIPAHSEVTFNYNLES
AGIEKKRCMCGAKRCSGYIGAKPKQDESLLKKPKRPYKKRKIEESPSTKVKPKRPLGRPP
KPKELTEIEKDLLIIKNATNDISSDDSNKHSSEGDRPKAMKRRRVSFNNEDSVSVDGEMQ
SKKSKSD
*(101 a.a.)

- SilkBase 1999-2023 -