SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1625_internal:A_BomoMSG_c7830_g1_i1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)		protein_gustavus_isoform_X4_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005938 C cell cortex
GO:0007275 P multicellular organism development
GO:0007280 P pole cell migration
GO:0007281 P germ cell development
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007315 P pole plasm assembly
GO:0007472 P wing disc morphogenesis
GO:0008104 P protein localization
GO:0031466 C Cul5-RING ubiquitin ligase complex
GO:0035017 P cuticle pattern formation
GO:0035556 P intracellular signal transduction
GO:0045495 C pole plasm
GO:0045732 P positive regulation of protein catabolic process
GO:0046843 P dorsal appendage formation
GO:0048471 C perinuclear region of cytoplasm
GO:0070449 C elongin complex
RNA-seq EntryA_BomoMSG_c7830_g1_i1
Sequence
(Amino Acid)
DALTFHRHPVAQSTDCIRGRTGYTRGLHCWEVVWPARQRGTHAVVGVATSHAPLHSVGYQ
SLVGATDQSWGWDLGRNKVFHNAKGTGGGGTTYPALLRPDEQFL
(33 a.a.)

- SilkBase 1999-2023 -