SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG16224_5prime_partial:A_BomoMSG_c25435_g1_i4
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
RGS-GAIP_interacting_protein_GIPC_[Bombyx_mori]
Ontology
GO:0003779 F actin binding
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005903 C brush border
GO:0005938 C cell cortex
GO:0006605 P protein targeting
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007268 P chemical synaptic transmission
GO:0008021 C synaptic vesicle
GO:0012506 C vesicle membrane
GO:0014047 P glutamate secretion
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0017022 F myosin binding
GO:0030139 C endocytic vesicle
GO:0030165 F PDZ domain binding
GO:0030511 P positive regulation of transforming growth factor beta receptor signaling pathway
GO:0031647 P regulation of protein stability
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032467 P positive regulation of cytokinesis
GO:0042803 F protein homodimerization activity
GO:0043197 C dendritic spine
GO:0043198 C dendritic shaft
GO:0043542 P endothelial cell migration
GO:0048167 P regulation of synaptic plasticity
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoMSG_c25435_g1_i4
Sequence
(Amino Acid)
SSDLTFIMRLVEPLKSGFGSIGPKTGSGRSGKKQNFGSGKETLRFKANGQATIENEHDDK
SKAGIEKINGLLESFMGINDSELASQMWDLAEGKQNSMELAEAIDNSDLQEFGFTDEFII
ELWGVITDARSGRLS
*(44 a.a.)

- SilkBase 1999-2023 -