SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG16107_5prime_partial:A_BomoMSG_c25392_g1_i1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
protein_transport_protein_Sec24A_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0002474 P antigen processing and presentation of peptide antigen via MHC class I
GO:0003674 F molecular_function
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0008270 F zinc ion binding
GO:0012507 C ER to Golgi transport vesicle membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0030127 C COPII vesicle coat
GO:0045714 P obsolete regulation of low-density lipoprotein particle receptor biosynthetic process
GO:0048208 P COPII vesicle coating
GO:0048471 C perinuclear region of cytoplasm
GO:0050714 P positive regulation of protein secretion
GO:2000189 P cholesterol homeostasis
RNA-seq EntryA_BomoMSG_c25392_g1_i1
Sequence
(Amino Acid)
PHDAPCPPRLHLSAERINSNGAYLLDDGECMIIYVCHGVAPAFLADAFGVSAHAQLGDEG
RALPRLDTEPSALLHAFIDKLNDDRPYASEILILKDNSPSRHLFLERLVDDRVESAFSYY
EFLQHIKSLVK
*(43 a.a.)

- SilkBase 1999-2023 -