SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1605_internal:A_BomoMSG_c7798_g1_i1
Scaffold_idBomo_Chr14
NCBI non-redundant
(nr)
centromere/kinetochore_protein_zw10_[Bombyx_mori]
Ontology
GO:0000070 P mitotic sister chromatid segregation
GO:0000278 P mitotic cell cycle
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0000940 C outer kinetochore
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005795 C Golgi stack
GO:0005819 C spindle
GO:0005828 C kinetochore microtubule
GO:0005856 C cytoskeleton
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007030 P Golgi organization
GO:0007049 P cell cycle
GO:0007059 P chromosome segregation
GO:0007060 P male meiosis chromosome segregation
GO:0007067 P mitotic cell cycle
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0007107 P membrane addition at site of cytokinesis
GO:0007112 P male meiosis cytokinesis
GO:0017137 F small GTPase binding
GO:0022008 P neurogenesis
GO:0036063 C acroblast
GO:0036090 P cleavage furrow ingression
GO:0048193 P Golgi vesicle transport
GO:0051233 C spindle midzone
GO:0051301 P cell division
GO:0051321 P meiotic cell cycle
GO:0070939 C Dsl1/NZR complex
GO:1990423 C RZZ complex
RNA-seq EntryA_BomoMSG_c7798_g1_i1
Sequence
(Amino Acid)
LKTSWLHILPSRMYVMSMCTLIEVLCETVLNRIFCDIKHVSEDLVYLIATRIEDTLEEVV
TLFEEPIELEEQISIWIKFSRMPLLLKAQLLEISELWNKDRELFSDYTCE
(35 a.a.)

- SilkBase 1999-2023 -