SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1593_internal:A_BomoMSG_c7764_g1_i1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_histone-lysine_N-methyltransferase_2C_[Bombyx_mori]
Ontology
GO:0003713 F transcription coactivator activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005700 C polytene chromosome
GO:0005703 C polytene chromosome puff
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007224 P smoothened signaling pathway
GO:0007275 P multicellular organism development
GO:0007458 P progression of morphogenetic furrow involved in compound eye morphogenesis
GO:0008168 F methyltransferase activity
GO:0016568 P chromatin organization
GO:0016571 P histone methylation
GO:0016740 F transferase activity
GO:0018024 F histone-lysine N-methyltransferase activity
GO:0032259 P methylation
GO:0035075 P response to ecdysone
GO:0035332 P positive regulation of hippo signaling
GO:0042054 F histone methyltransferase activity
GO:0042800 F histone methyltransferase activity (H3-K4 specific)
GO:0044666 C MLL3/4 complex
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0048749 P compound eye development
GO:0051568 P histone H3-K4 methylation
GO:1900114 P positive regulation of histone H3-K9 trimethylation
RNA-seq EntryA_BomoMSG_c7764_g1_i1
Sequence
(Amino Acid)
AAFHTPNYIYPIGYKIVRFYWSTQRANNRCRYLCWISEEEGRPRFHVRAQDEPRHEASAP
TPRAAWANILDAVASLREGRGEEGVLKLWPNYVTGEDLFGLTEPAVVRVLESLPGVETLT
D
(39 a.a.)

- SilkBase 1999-2023 -