SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG15662_5prime_partial:A_BomoMSG_c25218_g1_i3
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
spectrin_alpha_chain_isoform_X3_[Bombyx_mori]
Ontology
GO:0002168 P instar larval development
GO:0003779 F actin binding
GO:0005509 F calcium ion binding
GO:0005516 F calmodulin binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005811 C lipid droplet
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0007009 P plasma membrane organization
GO:0007026 P negative regulation of microtubule depolymerization
GO:0007274 P neuromuscular synaptic transmission
GO:0007293 P germarium-derived egg chamber formation
GO:0007294 P germarium-derived oocyte fate determination
GO:0007308 P oocyte construction
GO:0007417 P central nervous system development
GO:0008017 F microtubule binding
GO:0008091 C spectrin
GO:0008092 F cytoskeletal protein binding
GO:0008302 P female germline ring canal formation, actin assembly
GO:0008360 P regulation of cell shape
GO:0016199 P axon midline choice point recognition
GO:0016323 C basolateral plasma membrane
GO:0016337 P cell-cell adhesion
GO:0030707 P ovarian follicle cell development
GO:0030721 P spectrosome organization
GO:0030727 P germarium-derived female germ-line cyst formation
GO:0031594 C neuromuscular junction
GO:0042062 P long-term strengthening of neuromuscular junction
GO:0045169 C fusome
GO:0045170 C spectrosome
GO:0045478 P fusome organization
GO:0046872 F metal ion binding
GO:0048134 P germ-line cyst formation
GO:0048790 P maintenance of presynaptic active zone structure
GO:0050807 P regulation of synapse organization
GO:0051693 P actin filament capping
GO:0060429 P epithelium development
RNA-seq EntryA_BomoMSG_c25218_g1_i3
Sequence
(Amino Acid)
VLFRSAKIQKHQAFEAEVAAHSNAIVVLDNTGSEMIAAGHFASETIRRRLDELHRLWELL
LSRLAEKGMKLQQALVLVQFLRHCDEVMFWIHDKETFVCADEFGSDLEHVEVLQRKFDEF
QKDMAAQEYRVTEVNQLAERLVLEGHPERETIVKRKDELNEAWQRLRQMALMRQERLFGA
HEIQRFNRDADETIAWISEKDAVLGSDDYGRDLATVQTLQRKHEGVERDLPR
*(76 a.a.)

- SilkBase 1999-2023 -