SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG15530_internal:A_BomoMSG_c25169_g1_i2
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
Bloom_syndrome_protein_homolog_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000403 F Y-form DNA binding
GO:0000724 P double-strand break repair via homologous recombination
GO:0000731 P DNA synthesis involved in DNA repair
GO:0000732 P strand displacement
GO:0000733 P obsolete DNA strand renaturation
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0003824 F catalytic activity
GO:0004003 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007131 P reciprocal meiotic recombination
GO:0008026 F helicase activity
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0009378 F four-way junction helicase activity
GO:0016787 F hydrolase activity
GO:0032508 P DNA duplex unwinding
GO:0043140 F 3'-5' DNA helicase activity
GO:0044237 P cellular metabolic process
GO:0045003 P double-strand break repair via synthesis-dependent strand annealing
GO:1901291 P negative regulation of double-strand break repair via single-strand annealing
RNA-seq EntryA_BomoMSG_c25169_g1_i2
Sequence
(Amino Acid)
SSDLMDKSLDQSDTNVKKKGKFVYKSPLNHSSPDCIASSSTAERLKSIMETLKRVPPKVA
SNPTPQANNSSVEFQPPPLDRSAFLNTERPSTSATPASVTDVAENEYEHLFDASDGFEEN
IDLISENDVSVEEFQNGKNISVDDDGWPEYRMGDFADDVEVVNAVEMVEMNLNHTMTSNV
VNTKYEGIGQFEGDIQNDGTTGEFDGLNYPHSAPMLEIFREIGRA
(74 a.a.)

- SilkBase 1999-2023 -