SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG15254_complete:A_BomoMSG_c25085_g2_i2
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)
apolipoprotein_D_[Bombyx_mori]
Ontology
GO:0000302 P response to reactive oxygen species
GO:0005215 F transporter activity
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005622 C intracellular anatomical structure
GO:0005783 C endoplasmic reticulum
GO:0006006 P glucose metabolic process
GO:0006629 P lipid metabolic process
GO:0006810 P transport
GO:0007420 P brain development
GO:0007568 P aging
GO:0008289 F lipid binding
GO:0010642 P negative regulation of platelet-derived growth factor receptor signaling pathway
GO:0014012 P peripheral nervous system axon regeneration
GO:0015485 F cholesterol binding
GO:0022626 C cytosolic ribosome
GO:0030425 C dendrite
GO:0042246 P tissue regeneration
GO:0042308 P negative regulation of protein import into nucleus
GO:0042493 P response to xenobiotic stimulus
GO:0043025 C neuronal cell body
GO:0048471 C perinuclear region of cytoplasm
GO:0048662 P negative regulation of smooth muscle cell proliferation
GO:0048678 P response to axon injury
GO:0051895 P negative regulation of focal adhesion assembly
GO:0060588 P negative regulation of lipoprotein lipid oxidation
GO:0070062 C extracellular exosome
GO:0071638 P negative regulation of monocyte chemotactic protein-1 production
GO:1900016 P negative regulation of cytokine production involved in inflammatory response
GO:2000098 P negative regulation of smooth muscle cell-matrix adhesion
GO:2000405 P negative regulation of T cell migration
RNA-seq EntryA_BomoMSG_c25085_g2_i2
Sequence
(Amino Acid)
MSGRELIAAYKIWLLFGALAEVVTGTGFGRCPAYPSLPNFDAQRMTGIWYEVERSFYLVE
IAASCTRLNVTLNDRGYFQITVDSVNRWTGSQSTSYGIGIPSYNGSSVFRYKLNNRMPYL
IGRLLPGAGQYNILFTDYDQFALVWSCSSVSLAHSDRIWVLGRKQEIEADVRVQIYAIMQ
ELRLDPDRLFISKNTNCTDSLEAE
*(67 a.a.)

- SilkBase 1999-2023 -