SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1524_internal:A_BomoMSG_c7497_g1_i2
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
ATP-dependent_DNA_helicase_PIF1-like_[Bombyx_mori]
Ontology
GO:0000002 P mitochondrial genome maintenance
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0000723 P telomere maintenance
GO:0003677 F DNA binding
GO:0003678 F DNA helicase activity
GO:0004003 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005657 C replication fork
GO:0005739 C mitochondrion
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0010521 F telomerase inhibitor activity
GO:0016787 F hydrolase activity
GO:0032211 P negative regulation of telomere maintenance via telomerase
GO:0032508 P DNA duplex unwinding
GO:0043141 F 5'-3' DNA helicase activity
GO:0044806 P G-quadruplex DNA unwinding
GO:0051276 P chromosome organization
GO:0051974 P negative regulation of telomerase activity
RNA-seq EntryA_BomoMSG_c7497_g1_i2
Sequence
(Amino Acid)
EFLNSLDVPGLPPHNLRLKVGSVVIMLRNINQPKLCNGTRLVRKLMNNVIYATIMIGKFK
GEEVLIPRIPMIPTDMPFEFKRLQFPIRLAFAMTINKSQGQSLKVCGLNLEHSCFS
(37 a.a.)

- SilkBase 1999-2023 -