SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG15120_3prime_partial:A_BomoMSG_c25053_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
PREDICTED:_dual_specificity_mitogen-activated_protein_kinase_kinase_4-like_[Amyelois_transitella]
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0007254 P JNK cascade
GO:0007257 P obsolete activation of JUN kinase activity
GO:0009611 P response to wounding
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0034393 P positive regulation of smooth muscle cell apoptotic process
GO:0071260 P cellular response to mechanical stimulus
GO:2000672 P negative regulation of motor neuron apoptotic process
RNA-seq EntryA_BomoMSG_c25053_g1_i1
Sequence
(Amino Acid)
MSKNGELSSNQGPSRPSLPRPELNLFGTEKRKILDLPLSGPSSDVAFVPFSSTTAQMQKP
KIPSRTIRDVLPENARDRCRIYPSMQSSGKLQLSATEVYDFTADDLQDLGEI
(36 a.a.)

- SilkBase 1999-2023 -