SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG14_3prime_partial:A_BomoMSG_c107_g1_i1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)
centrin_[Bombyx_mori]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000715 P nucleotide-excision repair, DNA damage recognition
GO:0000717 P nucleotide-excision repair, DNA duplex unwinding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005814 C centriole
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005929 C cilium
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006294 P nucleotide-excision repair, preincision complex assembly
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007099 P centriole replication
GO:0007283 P spermatogenesis
GO:0008017 F microtubule binding
GO:0016925 P protein sumoylation
GO:0031683 F G-protein beta/gamma-subunit complex binding
GO:0032391 C photoreceptor connecting cilium
GO:0032465 P regulation of cytokinesis
GO:0032795 F heterotrimeric G-protein binding
GO:0036064 C ciliary basal body
GO:0046872 F metal ion binding
GO:0051301 P cell division
GO:0070911 P global genome nucleotide-excision repair
GO:0071942 C XPC complex
RNA-seq EntryA_BomoMSG_c107_g1_i1
Sequence
(Amino Acid)
MATAVATIQKKTATTNPGPGGVRKKSGPKFELTEEQKRDIKEAFDLFDTENTGKIDTKEL
KVAIRALGFEPKKEEIKKMIAEIDKGDGKVSFDDFMELMSVKMAEKDTREEIMKAFKLFD
DDETGKISFKNLKRVAKELGENLTDEELHEMIDEADRDGDG
(52 a.a.)

- SilkBase 1999-2023 -