SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG14999_5prime_partial:A_BomoMSG_c25010_g1_i4
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_eIF-2-alpha_kinase_activator_GCN1_[Helicoverpa_armigera]
Ontology
GO:0005737 C cytoplasm
GO:0005840 C ribosome
GO:0005844 C polysome
GO:0006412 P translation
GO:0006417 P regulation of translation
GO:0008135 F translation factor activity, RNA binding
GO:0016020 C membrane
GO:0019887 F protein kinase regulator activity
GO:0019901 F protein kinase binding
GO:0033554 P cellular response to stress
GO:0033674 P positive regulation of kinase activity
GO:0034198 P cellular response to amino acid starvation
GO:0036003 P positive regulation of transcription from RNA polymerase II promoter in response to stress
GO:0043022 F ribosome binding
GO:0044822 F RNA binding
GO:0045859 P regulation of protein kinase activity
GO:1990253 P cellular response to leucine starvation
RNA-seq EntryA_BomoMSG_c25010_g1_i4
Sequence
(Amino Acid)
ALPISQFVRSMNHQSNEVKQMMARASGALGREADNPELLRAVLPALVNGTKEKNSYVRAN
AESSLRTLLRLHSEPDYFQRCVSFLEEGAREALSDVVARVLRRPQPDGRDEDLDCTLIT
*(39 a.a.)

- SilkBase 1999-2023 -