SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG14953_internal:A_BomoMSG_c24989_g1_i3
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
protein_piccolo_[Bombyx_mori]
Ontology
GO:0003824 F catalytic activity
GO:0004721 F phosphoprotein phosphatase activity
GO:0004722 F protein serine/threonine phosphatase activity
GO:0005515 F protein binding
GO:0005829 C cytosol
GO:0006469 P negative regulation of protein kinase activity
GO:0006470 P protein dephosphorylation
GO:0006915 P apoptotic process
GO:0010628 P positive regulation of gene expression
GO:0010634 P positive regulation of epithelial cell migration
GO:0010811 P positive regulation of cell-substrate adhesion
GO:0016576 P histone dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0033137 P negative regulation of peptidyl-serine phosphorylation
GO:0033192 F calmodulin-dependent protein phosphatase activity
GO:0035690 P cellular response to xenobiotic stimulus
GO:0035970 P peptidyl-threonine dephosphorylation
GO:0043169 F cation binding
GO:0043234 C protein-containing complex
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0044387 P negative regulation of protein kinase activity by regulation of protein phosphorylation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045927 P positive regulation of growth
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0050921 P positive regulation of chemotaxis
GO:0051496 P positive regulation of stress fiber assembly
GO:0051894 P positive regulation of focal adhesion assembly
GO:0097193 P intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoMSG_c24989_g1_i3
Sequence
(Amino Acid)
ALPICDKDDYLTSYRVFFENFAATVNPEDQLPVNIAGYTITEAELPGEVIYWTTQYLTEK
QCPLTLMTPLRRIVLDEVRVASKKHPAEFGYKSDESVYIALRLMQAVTARVNNVCLRYLD
NSKLDTLPPPPPIAQRDLKTVSCATKNGRRVMEDRHVEFGNLEALFGKETTEPTSFYAVY
DGHAGSAAATYCAAHLHQYLIESPHFTTDLQRAMRDAFLRTDAEFIRKSNQERANGGSTA
VAVCLRGSQLLAAWAGDSLALLAKRMRLMQLVRPHKPGRQ
(92 a.a.)

- SilkBase 1999-2023 -