SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG14835_internal:A_BomoMSG_c24951_g1_i2
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		verprolin_isoform_X3_[Bombyx_mori]
Ontology
GO:0000976 F transcription cis-regulatory region binding
GO:0001105 F transcription coactivator activity
GO:0001764 P neuron migration
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0003779 F actin binding
GO:0003785 F actin monomer binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0010735 P positive regulation of transcription via serum response element binding
GO:0030036 P actin cytoskeleton organization
GO:0030900 P forebrain development
GO:0031175 P neuron projection development
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043522 F leucine zipper domain binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051145 P smooth muscle cell differentiation
GO:2001234 P negative regulation of apoptotic signaling pathway
RNA-seq EntryA_BomoMSG_c24951_g1_i2
Sequence
(Amino Acid)
CSSDLRAKTGDLLKAKIQRRPDRQELERRHILEQESHVDPSLAEKQRMLKKARLADQLND
QLSHRPGPLELIKKNILHTEENIETAVKSGILAFKATSEGASGRPQHPSSYCGPPDEVSP
SPSPPSTLSPISVTSPPQHPAPGKEKNRKKNKQKQQPKARFKFHEYKGPPNAQKASSPPG
TVETPYELLLQQQQLLLQLMLPASPAPSTASVTSDCSDVLPAPPPPPLPPAPP
(76 a.a.)

- SilkBase 1999-2023 -