| Name | O_BomoMSG1481_3prime_partial:A_BomoMSG_c7278_g1_i1 |
| Scaffold_id | Bomo_Chr5 |
NCBI non-redundant
(nr) | Cullin-associated_NEDD8-dissociated_protein_1_[Papilio_xuthus] |
| Ontology |
| GO:0000151 |
C |
ubiquitin ligase complex |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0005654 |
C |
nucleoplasm |
| GO:0005737 |
C |
cytoplasm |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0010265 |
P |
SCF complex assembly |
| GO:0016020 |
C |
membrane |
| GO:0016567 |
P |
protein ubiquitination |
| GO:0017025 |
F |
TBP-class protein binding |
| GO:0030154 |
P |
cell differentiation |
| GO:0031461 |
C |
cullin-RING ubiquitin ligase complex |
| GO:0043086 |
P |
negative regulation of catalytic activity |
| GO:0045893 |
P |
positive regulation of transcription, DNA-templated |
| GO:0045899 |
P |
positive regulation of RNA polymerase II transcription preinitiation complex assembly |
| GO:0070062 |
C |
extracellular exosome |
|
| RNA-seq Entry | A_BomoMSG_c7278_g1_i1 |
Sequence
(Amino Acid) | MANVSYHIAHLLEKMTSNDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMLLRLLEDK
NGEVQNLAVKCLGPLVNKVKEYQVEGIVDTLCANMLSDTEQLRDIS
(34 a.a.) |
