SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG14795_complete:A_BomoMSG_c24938_g5_i5
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
glutamate_receptor_ionotropic,_delta-1-like_[Bombyx_mori]
Ontology
GO:0001966 P thigmotaxis
GO:0004872 F signaling receptor activity
GO:0004970 F ionotropic glutamate receptor activity
GO:0004971 F AMPA glutamate receptor activity
GO:0005216 F ion channel activity
GO:0005234 F extracellularly glutamate-gated ion channel activity
GO:0005515 F protein binding
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006972 P hyperosmotic response
GO:0007614 P short-term memory
GO:0007631 P feeding behavior
GO:0008306 P associative learning
GO:0008328 C ionotropic glutamate receptor complex
GO:0008344 P adult locomotory behavior
GO:0009612 P response to mechanical stimulus
GO:0009986 C cell surface
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019899 F enzyme binding
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0032589 C neuron projection membrane
GO:0034220 P ion transmembrane transport
GO:0035235 P ionotropic glutamate receptor signaling pathway
GO:0035249 P synaptic transmission, glutamatergic
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043056 P forward locomotion
GO:0043058 P regulation of backward locomotion
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046959 P habituation
GO:0050913 P sensory perception of bitter taste
GO:0055037 C recycling endosome
GO:0097038 C perinuclear endoplasmic reticulum
RNA-seq EntryA_BomoMSG_c24938_g5_i5
Sequence
(Amino Acid)
MLLTMSALSQQGCFIEPKRAPGRIMLFVLFTALMALYAAYSANIVVLLQAPSNSITSLAQ
LAASKVTLAANDVDYNHFVFSLYKDPVRVMIHKRIDPETGNGQFYSLEDGVDMIRQGFFA
FHSIVEPVYRRIEETFLETEKCDLTEVDFLSSFDPFVPVKKDSPYLELLRVVFKQIRESG
IQSALNRRYQVPKPRCSNKVAAFSSVGIVDLRPVLIMMIYGIISSCLILIMEMLVFKIAH
H
*(79 a.a.)

- SilkBase 1999-2023 -