EntryView

ORF from Assembled RNA_seq Entry

Name

O_BomoMSG14771_5prime_partial:A_BomoMSG_c24928_g1_i1

Scaffold_id

NCBI non-redundant
(nr)

ruvB-like_helicase_1_[Bombyx_mori]

Ontology

GO:0000166	F	nucleotide binding
GO:0000812	C	Swr1 complex
GO:0003678	F	DNA helicase activity
GO:0004386	F	helicase activity
GO:0005515	F	protein binding
GO:0005524	F	ATP binding
GO:0005634	C	nucleus
GO:0005654	C	nucleoplasm
GO:0005737	C	cytoplasm
GO:0005794	C	Golgi apparatus
GO:0005815	C	microtubule organizing center
GO:0005856	C	cytoskeleton
GO:0006281	P	DNA repair
GO:0006310	P	DNA recombination
GO:0006351	P	transcription, DNA-templated
GO:0006355	P	regulation of transcription, DNA-templated
GO:0006357	P	regulation of transcription by RNA polymerase II
GO:0006974	P	cellular response to DNA damage stimulus
GO:0007049	P	cell cycle
GO:0007067	P	mitotic cell cycle
GO:0007283	P	spermatogenesis
GO:0016020	C	membrane
GO:0016363	C	nuclear matrix
GO:0016568	P	chromatin organization
GO:0016787	F	hydrolase activity
GO:0016887	F	ATP hydrolysis activity
GO:0031011	C	Ino80 complex
GO:0032508	P	DNA duplex unwinding
GO:0034080	P	CENP-A containing chromatin assembly
GO:0035267	C	NuA4 histone acetyltransferase complex
GO:0040008	P	regulation of growth
GO:0043231	C	intracellular membrane-bounded organelle
GO:0043967	P	histone H4 acetylation
GO:0043968	P	histone H2A acetylation
GO:0051301	P	cell division
GO:0070062	C	extracellular exosome
GO:0071339	C	MLL1 complex
GO:0097255	C	R2TP complex
GO:1903146	P	regulation of autophagy of mitochondrion
GO:1903955	P	positive regulation of protein targeting to mitochondrion
GO:1904837	P	beta-catenin-TCF complex assembly
GO:1904874	P	positive regulation of telomerase RNA localization to Cajal body

RNA-seq Entry

Sequence
(Amino Acid)

ALPISLDLLDRLLIIRTLPYNKAELLQILKLRAVTEGISIEDEALSALSEIGAHTTLRYA
VQLLTPAMLAARADGCQRISPAHVSSVHTLFLDAKASAKILTQHSDKYMQ
*(36 a.a.)

- SilkBase 1999-2023 -