SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG14673_internal:A_BomoMSG_c24900_g1_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
DNA_mismatch_repair_protein_Msh2_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000228 C nuclear chromosome
GO:0000287 F magnesium ion binding
GO:0000400 F four-way junction DNA binding
GO:0000403 F Y-form DNA binding
GO:0000404 F heteroduplex DNA loop binding
GO:0000406 F double-strand/single-strand DNA junction binding
GO:0000710 P meiotic mismatch repair
GO:0000784 C chromosome, telomeric region
GO:0001701 P in utero embryonic development
GO:0002204 P somatic recombination of immunoglobulin genes involved in immune response
GO:0003677 F DNA binding
GO:0003684 F damaged DNA binding
GO:0003690 F double-stranded DNA binding
GO:0003697 F single-stranded DNA binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006119 P oxidative phosphorylation
GO:0006281 P DNA repair
GO:0006298 P mismatch repair
GO:0006301 P postreplication repair
GO:0006302 P double-strand break repair
GO:0006311 P meiotic gene conversion
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0007131 P reciprocal meiotic recombination
GO:0007281 P germ cell development
GO:0008022 F protein C-terminus binding
GO:0008340 P determination of adult lifespan
GO:0008584 P male gonad development
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010165 P response to X-ray
GO:0010224 P response to UV-B
GO:0016020 C membrane
GO:0016446 P somatic hypermutation of immunoglobulin genes
GO:0016447 P somatic recombination of immunoglobulin gene segments
GO:0016887 F ATP hydrolysis activity
GO:0019237 F centromeric DNA binding
GO:0019724 P B cell mediated immunity
GO:0019899 F enzyme binding
GO:0019901 F protein kinase binding
GO:0030183 P B cell differentiation
GO:0030983 F mismatched DNA binding
GO:0031573 P mitotic intra-S DNA damage checkpoint signaling
GO:0032137 F guanine/thymine mispair binding
GO:0032138 F single base insertion or deletion binding
GO:0032139 F dinucleotide insertion or deletion binding
GO:0032142 F single guanine insertion binding
GO:0032143 F single thymine insertion binding
GO:0032181 F dinucleotide repeat insertion binding
GO:0032300 C mismatch repair complex
GO:0032301 C MutSalpha complex
GO:0032302 C MutSbeta complex
GO:0032357 F oxidized purine DNA binding
GO:0032405 F MutLalpha complex binding
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0042803 F protein homodimerization activity
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043531 F ADP binding
GO:0043570 P maintenance of DNA repeat elements
GO:0045128 P negative regulation of reciprocal meiotic recombination
GO:0045190 P isotype switching
GO:0045910 P negative regulation of DNA recombination
GO:0051096 P positive regulation of helicase activity
RNA-seq EntryA_BomoMSG_c24900_g1_i1
Sequence
(Amino Acid)
IGRAYLTQLEEVLGEGLGGSDENTPCLMAVNIKTDPVSKGKLLGVACVVAADYQMSVSEF
TDDDLLTQLETITVQTAPSECLIPFSDNDDYKALKKVMDRTNVTVTKLKRVDFSTEGLVQ
DLNRLLNFKEDQQQDANAFPETRKDLAMTSLAATIKYSALLNESTNFGRFRLSTIRTDCF
LHLDAAALTALNILPELGDNSNSPSRSLFGLLDRCRTQHGKRLLAQWLRQPLRDINLINE
RLDVVELLMNNSQLRLQLHEDHLRRIPDLQALTRRLARKKANLHDCYKIYQAIKRLPSLL
QCLTEAENTTVHSSLTEPISELNDDLDKFQQMIEATLDMGAVERGDFLVKPSFDEQLQSL
NEQLERLQSSAERELGKAARDLGLDAGKTIKLENNTQNGFCFRITLKEERNLRGDKKYKI
IDAVKSGVRFRTNTLESINEEYTQAKTDYEKEQDKVVKEIVSIAGGYSECLFCLSHILSR
LDVLVSFAVAASSAPYPYCRPVVTESIDELILKDVRHPCLEVQEGVSYIPNDVEFKRGSV
(179 a.a.)

- SilkBase 1999-2023 -