| Name | O_BomoMSG14547_internal:A_BomoMSG_c24850_g2_i1 |
| Scaffold_id | Bomo_Chr26 |
NCBI non-redundant (nr) | cytochrome_P450_4V2_[Bombyx_mori] |
| Ontology |
| GO:0004497 |
F |
monooxygenase activity |
| GO:0005506 |
F |
iron ion binding |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0005789 |
C |
endoplasmic reticulum membrane |
| GO:0009055 |
F |
electron transfer activity |
| GO:0016020 |
C |
membrane |
| GO:0016491 |
F |
oxidoreductase activity |
| GO:0016705 |
F |
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
| GO:0020037 |
F |
heme binding |
| GO:0031090 |
C |
organelle membrane |
| GO:0043231 |
C |
intracellular membrane-bounded organelle |
| GO:0046872 |
F |
metal ion binding |
| GO:0055114 |
P |
obsolete oxidation-reduction process |
|
| RNA-seq Entry | A_BomoMSG_c24850_g2_i1 |
Sequence (Amino Acid) | VYTEAMIKEVLRLYNVLPAVLRDITEKVQLKNYTMYPGDQCMILINNLNRHKAWGLDVEQ
FRPERWLGEAELPEHHSAYFATFGIGRRFCIGRIFAMYSMKTILVHIL
(35 a.a.) |