SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG14384_5prime_partial:A_BomoMSG_c24775_g1_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_histone_deacetylase_Rpd3_[Bombyx_mori]
Ontology
GO:0000118 C histone deacetylase complex
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000785 C chromatin
GO:0003714 F transcription corepressor activity
GO:0004407 F histone deacetylase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0005705 C polytene chromosome interband
GO:0005737 C cytoplasm
GO:0006099 P tricarboxylic acid cycle
GO:0006342 P heterochromatin assembly
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007350 P blastoderm segmentation
GO:0007517 P muscle organ development
GO:0008134 F transcription factor binding
GO:0008340 P determination of adult lifespan
GO:0016458 P obsolete gene silencing
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0016580 C Sin3 complex
GO:0016581 C NuRD complex
GO:0016787 F hydrolase activity
GO:0017053 C transcription repressor complex
GO:0022008 P neurogenesis
GO:0022904 P respiratory electron transport chain
GO:0031523 C Myb complex
GO:0032041 F NAD-dependent histone deacetylase activity (H3-K14 specific)
GO:0035065 P regulation of histone acetylation
GO:0035098 C ESC/E(Z) complex
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0048477 P oogenesis
GO:0048813 P dendrite morphogenesis
GO:0050771 P negative regulation of axonogenesis
GO:0070822 C Sin3-type complex
GO:0070932 P histone H3 deacetylation
GO:0070983 P dendrite guidance
GO:2001229 P negative regulation of response to gamma radiation
RNA-seq EntryA_BomoMSG_c24775_g1_i1
Sequence
(Amino Acid)
GKGKYYAVNIPLRDGMDDESYESIFVPIISKVMETFQPSAVVLQCGADSLTGDRLGCFNL
TVRGHGRCVELVKRFGLPFLLVGGGGYTIRNVSRCWTYETSVALGVEIANELPYNDYFEY
FGPDFKLHISPSNMSNQNTPEYLEKIKNRLFENLRMLPHAPGVQVQAIPEDAVNDESDDE
DKIDKDERLPQSDKDKRIANDGELSDSEDEGDGRRDNRAYRAPQRKRPRLDKEPLQIKDD
LKPDDMKDDVKNVSNAEESKKDMPPNP
*(88 a.a.)

- SilkBase 1999-2023 -