SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG14136_internal:A_BomoMSG_c24671_g1_i2
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
ephrin_type-B_receptor_1-B_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000902 P cell morphogenesis
GO:0001525 P angiogenesis
GO:0001655 P urogenital system development
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0004872 F signaling receptor activity
GO:0005003 F ephrin receptor activity
GO:0005005 F transmembrane-ephrin receptor activity
GO:0005102 F signaling receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0007413 P axonal fasciculation
GO:0007612 P learning
GO:0008046 F axon guidance receptor activity
GO:0009887 P animal organ morphogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0021631 P optic nerve morphogenesis
GO:0021952 P central nervous system projection neuron axonogenesis
GO:0022038 P corpus callosum development
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031290 P retinal ganglion cell axon guidance
GO:0042472 P inner ear morphogenesis
GO:0042802 F identical protein binding
GO:0042995 C cell projection
GO:0043025 C neuronal cell body
GO:0045202 C synapse
GO:0048013 P ephrin receptor signaling pathway
GO:0048168 P regulation of neuronal synaptic plasticity
GO:0048170 P positive regulation of long-term neuronal synaptic plasticity
GO:0048593 P camera-type eye morphogenesis
GO:0050770 P regulation of axonogenesis
GO:0050771 P negative regulation of axonogenesis
GO:0050878 P regulation of body fluid levels
GO:0051965 P positive regulation of synapse assembly
GO:0060021 P roof of mouth development
GO:0060996 P dendritic spine development
GO:0060997 P dendritic spine morphogenesis
GO:0071679 P commissural neuron axon guidance
RNA-seq EntryA_BomoMSG_c24671_g1_i2
Sequence
(Amino Acid)
EIKEFAFRDQGACISILAVKVYYITCPDVNINFARFPATPTGREVTVIEQANGTCVANAE
VAPGEKAPVYLCKGDGKWTLPSGSCKCRAGFEPDHNNQICTECAPGKFKSHTGDEHCIPC
PDHSESTIYAAAECKCTPKYYRAKKDPKTIPCTQPPSAPDNLTVTFADQFSISLTWQPPH
NTGGRSDITYKISCANCGPTVEFRPGETG
(68 a.a.)

- SilkBase 1999-2023 -