SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG14134_3prime_partial:A_BomoMSG_c24671_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		ephrin_type-B_receptor_1-B_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001525 P angiogenesis
GO:0001771 P immunological synapse formation
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005003 F ephrin receptor activity
GO:0005005 F transmembrane-ephrin receptor activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007155 P cell adhesion
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0008046 F axon guidance receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0021545 P cranial nerve development
GO:0021631 P optic nerve morphogenesis
GO:0021952 P central nervous system projection neuron axonogenesis
GO:0022008 P neurogenesis
GO:0030010 P establishment of cell polarity
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031290 P retinal ganglion cell axon guidance
GO:0031589 P cell-substrate adhesion
GO:0031901 C early endosome membrane
GO:0032403 F protein-containing complex binding
GO:0032433 C filopodium tip
GO:0042995 C cell projection
GO:0045121 C membrane raft
GO:0046328 P regulation of JNK cascade
GO:0046777 P protein autophosphorylation
GO:0048013 P ephrin receptor signaling pathway
GO:0048593 P camera-type eye morphogenesis
GO:0050965 P detection of temperature stimulus involved in sensory perception of pain
GO:0051965 P positive regulation of synapse assembly
GO:0060326 P cell chemotaxis
GO:0060996 P dendritic spine development
GO:0060997 P dendritic spine morphogenesis
GO:0061351 P neural precursor cell proliferation
GO:0070062 C extracellular exosome
GO:0070372 P regulation of ERK1 and ERK2 cascade
GO:1901214 P regulation of neuron death
RNA-seq EntryA_BomoMSG_c24671_g1_i1
Sequence
(Amino Acid)
MIWLIVVTALASVHGEQVLLLDTTAEDTLGWTRFSYGAQASTAGWLEESYTNFEKQINWR
SYVVCDVAHHNVNNWLWTPFIERRNANRIYIEIKFTIRDCSLFPGNALSCKETFSLLYYE
FDVATREQPPWEPESYKLVGRIAAGEGRFNTNSEVDINTEVKSIAVTKKGVYFAFRDQGA
CISILAVKVYYITCPDVNINFARFPATPTGREVTVIEQANGTCVANAEVAPGEKAPVYLC
KGDGKWTLPSGSCKCRAGFEPDHNNQICTECAPGKFKSHTGDEHCIPCPDHSESTIYAAA
ECKCTPKYYRAKKDPKTIPCTQPPSAPDNLTVTFADQFSISLTWQPPHNTGGRSDITYKI
SCANCGPTVEFRPGETG
(124 a.a.)

- SilkBase 1999-2023 -