SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG14017_internal:A_BomoMSG_c24607_g2_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		ephrin_type-B_receptor_1-B_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005003 F ephrin receptor activity
GO:0005004 F GPI-linked ephrin receptor activity
GO:0005005 F transmembrane-ephrin receptor activity
GO:0005524 F ATP binding
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007155 P cell adhesion
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0031901 C early endosome membrane
GO:0043087 P regulation of GTPase activity
GO:0048013 P ephrin receptor signaling pathway
RNA-seq EntryA_BomoMSG_c24607_g2_i1
Sequence
(Amino Acid)
DVCSSDHPNQAVREFAREIDASCITIEAIIGGGEFGDVCRGKLKLPASCGPEIDVAIKTL
KPGSTERARRDFLAEASIMGQFEHPNVIFLQGVVTKCNPIMIITEFMENGSLDTFLRAND
GKFRVLQLVGMLRGIATGMQYLSEMNYIH
(48 a.a.)

- SilkBase 1999-2023 -