SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1396_internal:A_BomoMSG_c6497_g1_i1
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_ras-responsive_element-binding_protein_1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001779 P natural killer cell differentiation
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005721 C pericentric heterochromatin
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007049 P cell cycle
GO:0007275 P multicellular organism development
GO:0008187 F poly-pyrimidine tract binding
GO:0010628 P positive regulation of gene expression
GO:0016568 P chromatin organization
GO:0030097 P hemopoiesis
GO:0030098 P lymphocyte differentiation
GO:0030183 P B cell differentiation
GO:0030217 P T cell differentiation
GO:0030218 P erythrocyte differentiation
GO:0030900 P forebrain development
GO:0032968 P positive regulation of transcription elongation from RNA polymerase II promoter
GO:0032993 C protein-DNA complex
GO:0035881 P amacrine cell differentiation
GO:0040018 P positive regulation of multicellular organism growth
GO:0043234 C protein-containing complex
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045184 P establishment of protein localization
GO:0045579 P positive regulation of B cell differentiation
GO:0045660 P positive regulation of neutrophil differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045899 P positive regulation of RNA polymerase II transcription preinitiation complex assembly
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048535 P lymph node development
GO:0048538 P thymus development
GO:0048541 P Peyer's patch development
GO:0048732 P gland development
GO:0051138 P positive regulation of NK T cell differentiation
GO:0060040 P retinal bipolar neuron differentiation
GO:0060041 P retina development in camera-type eye
RNA-seq EntryA_BomoMSG_c6497_g1_i1
Sequence
(Amino Acid)
VIKNGVLMPKQKQRRYRTERPFSCSQCSARFTLRSNMERHVKQQHPQHWSVRRPAQRGPP
PYTSTDALADRVKFALLAHHLERPLQSERSPARRDSDEVADNEEDEDDALIIDEETDVET
KSEEHTAARQAAAEILMASRQQEINKDFDLKIAGNLINKPVPIAEKTESGPDPTPGQDLL
TVPVVPTHSDEEEDEEGLVASTSEGNNSE
(68 a.a.)

- SilkBase 1999-2023 -