| Name | O_BomoMSG1390_5prime_partial:A_BomoMSG_c6410_g1_i1 |
| Scaffold_id | Bomo_Chr22 |
NCBI non-redundant (nr) | DNA_N6-methyl_adenine_demethylase_isoform_X5_[Bombyx_mori] |
| Ontology |
| GO:0003677 |
F |
DNA binding |
| GO:0005634 |
C |
nucleus |
| GO:0007281 |
P |
germ cell development |
| GO:0008270 |
F |
zinc ion binding |
| GO:0016491 |
F |
oxidoreductase activity |
| GO:0035511 |
P |
oxidative DNA demethylation |
| GO:0035514 |
F |
DNA demethylase activity |
| GO:0035516 |
F |
oxidative DNA demethylase activity |
| GO:0045944 |
P |
positive regulation of transcription by RNA polymerase II |
| GO:0046872 |
F |
metal ion binding |
| GO:0051213 |
F |
dioxygenase activity |
| GO:0055114 |
P |
obsolete oxidation-reduction process |
| GO:1901537 |
P |
positive regulation of DNA demethylation |
|
| RNA-seq Entry | A_BomoMSG_c6410_g1_i1 |
Sequence (Amino Acid) | RSEERRVFYQHRNLNRPKHGLEEWEEKMRLKKLGLNPPTPSTPAPAAIAPTPVARPGPIG
PIAGPGSTGPRSAGPGPALVRAETHTTTSWTTLFPMHGCTVTGPYQESAT
*(36 a.a.) |