SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG138_5prime_partial:A_BomoMSG_c503_g1_i1
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
disks_large_homolog_5_isoform_X1_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005913 C adherens junction
GO:0006461 P protein-containing complex assembly
GO:0007165 P signal transduction
GO:0008013 F beta-catenin binding
GO:0008092 F cytoskeletal protein binding
GO:0008285 P negative regulation of cell population proliferation
GO:0016020 C membrane
GO:0016337 P cell-cell adhesion
GO:0030054 C cell junction
GO:0030159 F signaling receptor complex adaptor activity
GO:0030859 P polarized epithelial cell differentiation
GO:0030901 P midbrain development
GO:0035556 P intracellular signal transduction
GO:0042981 P regulation of apoptotic process
GO:0045176 P apical protein localization
GO:0045186 P zonula adherens assembly
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0060441 P epithelial tube branching involved in lung morphogenesis
GO:0071896 P protein localization to adherens junction
GO:0072205 P metanephric collecting duct development
RNA-seq EntryA_BomoMSG_c503_g1_i1
Sequence
(Amino Acid)
SMCYPPQGIHCILDISVATIEKLHKQQIYPIVLFIKFKSFKQIKEVKDTRYPSEKVSAKA
AKEMYEHGLKVENEYRSYISAEIPAGVNIAYMCTQIKEAVEEEQNKTLWVPSVQA
*(37 a.a.)

- SilkBase 1999-2023 -