SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG13889_complete:A_BomoMSG_c24555_g1_i2
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
Very_low-density_lipoprotein_receptor_[Papilio_xuthus]
Ontology
GO:0001666 P response to hypoxia
GO:0005509 F calcium ion binding
GO:0005634 C nucleus
GO:0005905 C clathrin-coated pit
GO:0006629 P lipid metabolic process
GO:0006810 P transport
GO:0006869 P lipid transport
GO:0006897 P endocytosis
GO:0006898 P receptor-mediated endocytosis
GO:0007166 P cell surface receptor signaling pathway
GO:0007507 P heart development
GO:0007584 P response to nutrient
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0009725 P response to hormone
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0021987 P cerebral cortex development
GO:0030229 F very-low-density lipoprotein particle receptor activity
GO:0030296 F protein tyrosine kinase activator activity
GO:0032496 P response to lipopolysaccharide
GO:0032869 P cellular response to insulin stimulus
GO:0034361 C very-low-density lipoprotein particle
GO:0034447 P very-low-density lipoprotein particle clearance
GO:0042149 P cellular response to glucose starvation
GO:0042493 P response to xenobiotic stimulus
GO:0045177 C apical part of cell
GO:0048471 C perinuclear region of cytoplasm
GO:0061098 P positive regulation of protein tyrosine kinase activity
GO:0071222 P cellular response to lipopolysaccharide
GO:0071347 P cellular response to interleukin-1
GO:0071456 P cellular response to hypoxia
RNA-seq EntryA_BomoMSG_c24555_g1_i2
Sequence
(Amino Acid)
MLKILREGIVLLAKEAHEAWKTEQAETAEETETVTEKDPTTDSEKTEPMPVYWESDKKEL
NNNNQQFIDLYLEDASLGRIPDTTEKPVIESHFKYAKVFQLPLKNIIFDGVPETPKVGTE
ISNSGRDAGVVAGIVVAVISGVLLLAAVIAGVMYRHYVHHNVTSMNFDNPVYRKTTEDQF
ALEKNGYAPGSKLYPSTVGEEAQEPLNKPNTEFV
*(70 a.a.)

- SilkBase 1999-2023 -