SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG13818_complete:A_BomoMSG_c24512_g1_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)		PREDICTED:_AP-1_complex_subunit_sigma-2_isoform_X2_[Plutella_xylostella]
Ontology
GO:0000139 C Golgi membrane
GO:0005515 F protein binding
GO:0005765 C lysosomal membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005905 C clathrin-coated pit
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0008565 F obsolete protein transporter activity
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0030117 C membrane coat
GO:0030119 C AP-type membrane coat adaptor complex
GO:0030659 C cytoplasmic vesicle membrane
GO:0030669 C clathrin-coated endocytic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0032588 C trans-Golgi network membrane
GO:0043231 C intracellular membrane-bounded organelle
GO:0050690 P regulation of defense response to virus by virus
RNA-seq EntryA_BomoMSG_c24512_g1_i1
Sequence
(Amino Acid)
MMQFMLLFSRQGKLRLQKWYVAHPDKLKKKITRELITTVLARKPKMCSFLEWKDVKVVYK
RYASLYFCCAMEQEDNELLTLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDELVLG
GELQETSKKNVLKAIAAQDLLQEEETPQGFFEDHGLG
*(51 a.a.)

- SilkBase 1999-2023 -