SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1360_5prime_partial:A_BomoMSG_c6209_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		G_protein_alpha_subunit_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001664 F G protein-coupled receptor binding
GO:0003384 P apical constriction involved in gastrulation
GO:0003924 F GTPase activity
GO:0004871 F obsolete signal transducer activity
GO:0005525 F GTP binding
GO:0005737 C cytoplasm
GO:0005834 C heterotrimeric G-protein complex
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007188 P adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007264 P small GTPase mediated signal transduction
GO:0007266 P Rho protein signal transduction
GO:0007275 P multicellular organism development
GO:0007369 P gastrulation
GO:0007370 P ventral furrow formation
GO:0007374 P posterior midgut invagination
GO:0008152 P metabolic process
GO:0008360 P regulation of cell shape
GO:0010004 P gastrulation involving germ band extension
GO:0016476 P regulation of embryonic cell shape
GO:0019001 F guanyl nucleotide binding
GO:0031526 C brush border membrane
GO:0031683 F G-protein beta/gamma-subunit complex binding
GO:0031752 F D5 dopamine receptor binding
GO:0046872 F metal ion binding
GO:0070252 P actin-mediated cell contraction
RNA-seq EntryA_BomoMSG_c6209_g1_i1
Sequence
(Amino Acid)
KWTQCFDSVTSILFLVSSSEFDQVLSEDRKTNRLEEALNIFDTIVNNVNFKGISIILFLN
KSDLLARKVASKETDIRWYYPQFAGDPHNLHDVQMYLLNMFANVRREPKTTLYHHFTTAI
DTHNIEVVFNSVKDTILNRNLESLMLQ
*(48 a.a.)

- SilkBase 1999-2023 -