SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG13590_5prime_partial:A_BomoMSG_c24412_g1_i2
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
PREDICTED:_E3_ubiquitin-protein_ligase_Nedd-4-like_[Ceratina_calcarata]
Ontology
GO:0002092 P positive regulation of receptor internalization
GO:0004842 F ubiquitin-protein transferase activity
GO:0005112 F Notch binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007411 P axon guidance
GO:0007528 P neuromuscular junction development
GO:0016199 P axon midline choice point recognition
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0017022 F myosin binding
GO:0019904 F protein domain specific binding
GO:0031623 P receptor internalization
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0045746 P negative regulation of Notch signaling pathway
GO:0045807 P positive regulation of endocytosis
GO:0051965 P positive regulation of synapse assembly
GO:0061630 F ubiquitin protein ligase activity
RNA-seq EntryA_BomoMSG_c24412_g1_i2
Sequence
(Amino Acid)
DRKSVYHANHLVVQWFWRVVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQLFTI
EKWGSPENYPRAHTCFNRIDLPPYESYQQLREKLIKAIEGSQGFAGVD
*(35 a.a.)

- SilkBase 1999-2023 -