SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1350_internal:A_BomoMSG_c6178_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
MAGUK_p55_subfamily_member_7_[Bombyx_mori]
Ontology
GO:0001841 P neural tube formation
GO:0001917 C photoreceptor inner segment
GO:0002011 P morphogenesis of an epithelial sheet
GO:0005634 C nucleus
GO:0005886 C plasma membrane
GO:0005923 C bicellular tight junction
GO:0007420 P brain development
GO:0008078 P mesodermal cell migration
GO:0016020 C membrane
GO:0016324 C apical plasma membrane
GO:0016332 P establishment or maintenance of polarity of embryonic epithelium
GO:0016337 P cell-cell adhesion
GO:0021744 P dorsal motor nucleus of vagus nerve development
GO:0030054 C cell junction
GO:0031226 C intrinsic component of plasma membrane
GO:0035050 P embryonic heart tube development
GO:0035088 P establishment or maintenance of apical/basal cell polarity
GO:0043296 C apical junction complex
GO:0045176 P apical protein localization
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045199 P maintenance of epithelial cell apical/basal polarity
GO:0048699 P generation of neurons
GO:0055008 P cardiac muscle tissue morphogenesis
GO:0060041 P retina development in camera-type eye
GO:0060042 P retina morphogenesis in camera-type eye
GO:0060059 P embryonic retina morphogenesis in camera-type eye
GO:0070830 P bicellular tight junction assembly
GO:0090162 P establishment of epithelial cell polarity
RNA-seq EntryA_BomoMSG_c6178_g1_i1
Sequence
(Amino Acid)
LVATDPEKYITPIPYTSRPIKSSEQNGKDYVFVTREKMEQDITDGKFIEHGEYKGNLYGT
AAESVETIINTGRVCVLSPHWQALKMLRTPRLRPYIVFIKPPSLERMV
(35 a.a.)

- SilkBase 1999-2023 -