SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG13330_internal:A_BomoMSG_c24296_g1_i3
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)
activin_receptor_type-1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001655 P urogenital system development
GO:0001701 P in utero embryonic development
GO:0001755 P neural crest cell migration
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004675 F transmembrane receptor protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007178 P transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007281 P germ cell development
GO:0007368 P determination of left/right symmetry
GO:0007507 P heart development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016361 F activin receptor activity, type I
GO:0016740 F transferase activity
GO:0023014 P signal transduction
GO:0032924 P activin receptor signaling pathway
GO:0046872 F metal ion binding
GO:0048179 C activin receptor complex
GO:0050431 F transforming growth factor beta binding
RNA-seq EntryA_BomoMSG_c24296_g1_i3
Sequence
(Amino Acid)
VLFRSASWKRETEVYSTVLLRHQNILAYVGSDMTSRGSCTQLWLITQYHPLGSLHEHLQR
GTLSRQQLAALSLSAASGLLHLHTQIHGTQGKPAIAHRDIKSKNILVKVNGECCIGDLGL
ALTAQHIEQGQQLHNPRQGTKRYMSPEMLDHTMQTD
(51 a.a.)

- SilkBase 1999-2023 -