SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG13261_5prime_partial:A_BomoMSG_c24256_g1_i2
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)		1-acylglycerol-3-phosphate_O-acyltransferase_ABHD5_isoform_X2_[Bombyx_mori]
Ontology
GO:0003841 F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0004806 F triglyceride lipase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006654 P phosphatidic acid biosynthetic process
GO:0008654 P phospholipid biosynthetic process
GO:0010891 P negative regulation of sequestering of triglyceride
GO:0010898 P positive regulation of triglyceride catabolic process
GO:0016740 F transferase activity
GO:0016746 F acyltransferase activity
GO:0030154 P cell differentiation
GO:0042171 F lysophosphatidic acid acyltransferase activity
GO:0043231 C intracellular membrane-bounded organelle
GO:0050996 P positive regulation of lipid catabolic process
GO:0051006 P positive regulation of lipoprotein lipase activity
RNA-seq EntryA_BomoMSG_c24256_g1_i2
Sequence
(Amino Acid)
CALPIYPMVKRIDKLSPALPITVLYGSRSWVDNSTGHVLSEHRPHSRTYVQVINGAGHHV
YLDKPELFNKYVLEACSRADEYDPRTSTVAEGDTNKTEEHNS
*(33 a.a.)

- SilkBase 1999-2023 -