SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG13192_5prime_partial:A_BomoMSG_c24234_g1_i2
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		MAP_kinase-activated_protein_kinase_2_isoform_X4_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004683 F calmodulin-dependent protein kinase activity
GO:0004871 F obsolete signal transducer activity
GO:0005516 F calmodulin binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0007155 P cell adhesion
GO:0007166 P cell surface receptor signaling pathway
GO:0008360 P regulation of cell shape
GO:0009651 P response to salt stress
GO:0009931 F calcium-dependent protein serine/threonine kinase activity
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0045793 P positive regulation of cell size
GO:0046328 P regulation of JNK cascade
GO:0046777 P protein autophosphorylation
RNA-seq EntryA_BomoMSG_c24234_g1_i2
Sequence
(Amino Acid)
HCCADSHILLCGFPPFYSNHGLAISPGMKKRIRLGQYDFPDPEWSSVSSEAKNLIRGMLS
VDPAKRMTIQQVMSSPWVRQYTQVPQTPLYTNTLLREAGDAWPDVQDEMTRSLATMRVDY
DQVQIKALEQSNNSLLNKRRNKVGA
*(47 a.a.)

- SilkBase 1999-2023 -