SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG13073_5prime_partial:A_BomoMSG_c24171_g1_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
zinc_finger_protein_26_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005634 C nucleus
GO:0006342 P heterochromatin assembly
GO:0007275 P multicellular organism development
GO:0007354 P zygotic determination of anterior/posterior axis, embryo
GO:0007400 P neuroblast fate determination
GO:0007402 P ganglion mother cell fate determination
GO:0007411 P axon guidance
GO:0007419 P ventral cord development
GO:0007443 P Malpighian tubule morphogenesis
GO:0007517 P muscle organ development
GO:0010629 P negative regulation of gene expression
GO:0010906 P regulation of glucose metabolic process
GO:0035206 P regulation of hemocyte proliferation
GO:0035220 P wing disc development
GO:0035282 P segmentation
GO:0035290 P trunk segmentation
GO:0040034 P regulation of development, heterochronic
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048749 P compound eye development
GO:0061332 P Malpighian tubule bud morphogenesis
RNA-seq EntryA_BomoMSG_c24171_g1_i1
Sequence
(Amino Acid)
SITTRDPKRFHCELCSMTFKTKSALKCHSVVHSGEKNFECEVCHKKYGRSRTLVEHMKIH
RNDRRWSCAACAQAFVQKCSLKNHIRVHHGELNGDQLLIYKEPEKT
*(34 a.a.)

- SilkBase 1999-2023 -