SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1290_internal:A_BomoMSG_c5869_g1_i1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
phospholipase_C_gamma_isoform_X1_[Bombyx_mori]
Ontology
GO:0001726 C ruffle
GO:0004435 F phosphatidylinositol phospholipase C activity
GO:0004871 F obsolete signal transducer activity
GO:0005158 F insulin receptor binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006629 P lipid metabolic process
GO:0006816 P calcium ion transport
GO:0007165 P signal transduction
GO:0007202 P activation of phospholipase C activity
GO:0008081 F phosphoric diester hydrolase activity
GO:0008180 C COP9 signalosome
GO:0009306 P protein secretion
GO:0009395 P phospholipid catabolic process
GO:0009629 P response to gravity
GO:0010243 P response to organonitrogen compound
GO:0010634 P positive regulation of epithelial cell migration
GO:0016042 P lipid catabolic process
GO:0016787 F hydrolase activity
GO:0030027 C lamellipodium
GO:0032959 P inositol trisphosphate biosynthetic process
GO:0035556 P intracellular signal transduction
GO:0038096 P Fc-gamma receptor signaling pathway involved in phagocytosis
GO:0042542 P response to hydrogen peroxide
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043278 P response to morphine
GO:0046872 F metal ion binding
GO:0051219 F phosphoprotein binding
GO:0071364 P cellular response to epidermal growth factor stimulus
GO:1901339 P regulation of store-operated calcium channel activity
RNA-seq EntryA_BomoMSG_c5869_g1_i1
Sequence
(Amino Acid)
ISEETVRRLVSEPDDNTVYGTPGYMDPTSFTSKVTVKALYDYRARQDDELSFCKHAIITN
VDKPDEGWWRGDYGGKRHHWFPANYVLEIEVPHTDRKSV
(32 a.a.)

- SilkBase 1999-2023 -