SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG12891_internal:A_BomoMSG_c24087_g1_i2
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)
lysine-specific_demethylase_lid_isoform_X1_[Bombyx_mori]
Ontology
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006325 P chromatin organization
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007275 P multicellular organism development
GO:0007526 P larval somatic muscle development
GO:0008270 F zinc ion binding
GO:0016491 F oxidoreductase activity
GO:0016568 P chromatin organization
GO:0016577 P histone demethylation
GO:0016706 F 2-oxoglutarate-dependent dioxygenase activity
GO:0032453 F histone H3-methyl-lysine-4 demethylase activity
GO:0032922 P circadian regulation of gene expression
GO:0034647 F histone H3-tri/di/monomethyl-lysine-4 demethylase activity
GO:0034720 P histone H3-K4 demethylation
GO:0034721 P histone H3-K4 demethylation, trimethyl-H3-K4-specific
GO:0043970 P histone H3-K9 acetylation
GO:0043992 F histone acetyltransferase activity (H3-K9 specific)
GO:0045475 P locomotor rhythm
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0051213 F dioxygenase activity
GO:0055114 P obsolete oxidation-reduction process
GO:0070822 C Sin3-type complex
RNA-seq EntryA_BomoMSG_c24087_g1_i2
Sequence
(Amino Acid)
WKRNFGTVEKEFWRIVSSIDEDVTVEYGADLHSMDHGSGFPTKSSAHLYPGEQQYADSSW
NLNNLPVLEGSVLGHINADISGMKIPWLYVGMCFATFCWHNEDHWSYSINYLHWGEPKTW
YGVPSSKAEQFEAAMKAEAPELFQLQPDLLHQFVTIMNPN
(52 a.a.)

- SilkBase 1999-2023 -