SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG12873_complete:A_BomoMSG_c24078_g1_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
PR_domain_zinc_finger_protein_5-like_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000902 P cell morphogenesis
GO:0001708 P cell fate specification
GO:0001827 P inner cell mass cell fate commitment
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007281 P germ cell development
GO:0007566 P embryo implantation
GO:0008168 F methyltransferase activity
GO:0009566 P fertilization
GO:0010468 P regulation of gene expression
GO:0016740 F transferase activity
GO:0019827 P stem cell population maintenance
GO:0030718 P germ-line stem cell population maintenance
GO:0031490 F chromatin DNA binding
GO:0032259 P methylation
GO:0034972 P histone H3-R26 methylation
GO:0035019 P somatic stem cell population maintenance
GO:0040029 P regulation of gene expression, epigenetic
GO:0040037 P negative regulation of fibroblast growth factor receptor signaling pathway
GO:0044030 P regulation of DNA methylation
GO:0046872 F metal ion binding
GO:0048873 P homeostasis of number of cells within a tissue
GO:0060817 P inactivation of paternal X chromosome
RNA-seq EntryA_BomoMSG_c24078_g1_i1
Sequence
(Amino Acid)
MNKKPRTGPRIRITRPRTRKNEEIDEKHYIYTCQYCRLKFTQNSQLFRHMTSNHEIQQKT
ATFECNECQIVFNKKSNLDLHCQTHHQIKSKSKCDSCAITFKSRYCLRRHLKLKQQLAEN
SCIHCQKKFTSKDGLAKHMRNKHCDQSVMFECRVCSVKFKAAESLQSHVNRIHRRL
*(58 a.a.)

- SilkBase 1999-2023 -