SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1278_internal:A_BomoMSG_c5783_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
zinc_transporter_ZIP10_[Bombyx_mori]
Ontology
GO:0005385 F zinc ion transmembrane transporter activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006829 P zinc ion transport
GO:0006882 P cellular zinc ion homeostasis
GO:0007275 P multicellular organism development
GO:0007280 P pole cell migration
GO:0007399 P nervous system development
GO:0007417 P central nervous system development
GO:0007506 P gonadal mesoderm development
GO:0008354 P germ cell migration
GO:0008406 P gonad development
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016477 P cell migration
GO:0022008 P neurogenesis
GO:0030001 P metal ion transport
GO:0030154 P cell differentiation
GO:0035147 P branch fusion, open tracheal system
GO:0035262 P gonad morphogenesis
GO:0046873 F metal ion transmembrane transporter activity
GO:0055085 P transmembrane transport
GO:0071578 P zinc ion import across plasma membrane
RNA-seq EntryA_BomoMSG_c5783_g1_i1
Sequence
(Amino Acid)
PKTFLEMCPALVYQLDQRSCYKTEVSPPKLDKIWTWIYATLAILVISATGLLGVAIVPLL
KSKIFSHILHFLVAVAVGTLCGDALLHLLPHALKSHGPPSEPQDETEVVLKCSVTFITIL
FFYTVEAIMQTVNGGHAHSHDQNKGIEEIKTDSTKQIEPIELGAMMPGSPPP
(56 a.a.)

- SilkBase 1999-2023 -