SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG12372_5prime_partial:A_BomoMSG_c23763_g1_i3
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
nuclear_distribution_protein_nudE-like_1-B_isoform_X2_[Bombyx_mori]
Ontology
GO:0000086 P G2/M transition of mitotic cell cycle
GO:0000132 P establishment of mitotic spindle orientation
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0001764 P neuron migration
GO:0005515 F protein binding
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005874 C microtubule
GO:0007020 P microtubule nucleation
GO:0007049 P cell cycle
GO:0007059 P chromosome segregation
GO:0007062 P sister chromatid cohesion
GO:0007067 P mitotic cell cycle
GO:0007100 P mitotic centrosome separation
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007405 P neuroblast proliferation
GO:0008017 F microtubule binding
GO:0016020 C membrane
GO:0016477 P cell migration
GO:0019904 F protein domain specific binding
GO:0021987 P cerebral cortex development
GO:0030154 P cell differentiation
GO:0030900 P forebrain development
GO:0031023 P microtubule organizing center organization
GO:0031616 C spindle pole centrosome
GO:0032154 C cleavage furrow
GO:0042802 F identical protein binding
GO:0045202 C synapse
GO:0047496 P vesicle transport along microtubule
GO:0051298 P centrosome duplication
GO:0051301 P cell division
GO:0051303 P establishment of chromosome localization
GO:0051642 P centrosome localization
RNA-seq EntryA_BomoMSG_c23763_g1_i3
Sequence
(Amino Acid)
LERSQYETNALENELQALKIDKDKQAAYVRELEQKNDDLERGQRVISESVSCIETMLNEA
YERNAVLENEVDEIENLRIKLQRANDEARDLKQELKVVERIPSSKKEEDENETTLTNGHL
SNSTRNQVEIETQTSIMSPQKREINGNAMTPSARVSAINLVGDLLRKVGALESKLASCRG
TVRPKEHSPNTTSEVNKDYRCVLKN
*(67 a.a.)

- SilkBase 1999-2023 -