SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG12369_internal:A_BomoMSG_c23763_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)		nuclear_distribution_protein_nudE-like_1_isoform_X1_[Bombyx_mori]
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0000226 P microtubule cytoskeleton organization
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0001764 P neuron migration
GO:0001833 P inner cell mass cell proliferation
GO:0005515 F protein binding
GO:0005635 C nuclear envelope
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005871 C kinesin complex
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0006508 P proteolysis
GO:0006810 P transport
GO:0007020 P microtubule nucleation
GO:0007059 P chromosome segregation
GO:0007100 P mitotic centrosome separation
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0008017 F microtubule binding
GO:0008021 C synaptic vesicle
GO:0008090 P retrograde axonal transport
GO:0010975 P regulation of neuron projection development
GO:0016477 P cell migration
GO:0021799 P cerebral cortex radially oriented cell migration
GO:0021955 P central nervous system neuron axonogenesis
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0031175 P neuron projection development
GO:0031252 C cell leading edge
GO:0032403 F protein-containing complex binding
GO:0033157 P regulation of intracellular protein transport
GO:0043014 F alpha-tubulin binding
GO:0043203 C axon hillock
GO:0043547 P positive regulation of GTPase activity
GO:0044297 C cell body
GO:0045773 P positive regulation of axon extension
GO:0047496 P vesicle transport along microtubule
GO:0048487 F beta-tubulin binding
GO:0048680 P positive regulation of axon regeneration
GO:0051081 P nuclear membrane disassembly
GO:0051303 P establishment of chromosome localization
GO:0051642 P centrosome localization
GO:0060052 P neurofilament cytoskeleton organization
GO:0060053 C neurofilament cytoskeleton
GO:0070012 F oligopeptidase activity
GO:0090630 P activation of GTPase activity
GO:1904115 C axon cytoplasm
GO:1990138 P neuron projection extension
RNA-seq EntryA_BomoMSG_c23763_g1_i1
Sequence
(Amino Acid)
LERSQYETNALENELQALKIDKDKQAAYVRELEQKNDDLERGQRVISESVSCIETMLNEA
YERNAVLENEVDEIENLRIKLQRANDEARDLKQELKVVERIPSSKKEEDENETTLTNGHL
SNSTRNQVEIETQTSIMSPQKREINGNAMTPSARVSAINLVGDLLRKVGLERFLCRDCGK
IKCSCNTP
(61 a.a.)

- SilkBase 1999-2023 -