SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG12350_5prime_partial:A_BomoMSG_c23748_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
coiled-coil_and_C2_domain-containing_protein_1-like_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000281 P mitotic cytokinesis
GO:0000981 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005543 F phospholipid binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006886 P intracellular protein transport
GO:0007219 P Notch signaling pathway
GO:0007423 P sensory organ development
GO:0007472 P wing disc morphogenesis
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0008593 P regulation of Notch signaling pathway
GO:0016197 P endosomal transport
GO:0016324 C apical plasma membrane
GO:0030100 P regulation of endocytosis
GO:0036257 P multivesicular body organization
GO:0045035 P sensory organ precursor cell division
GO:0045732 P positive regulation of protein catabolic process
GO:0045746 P negative regulation of Notch signaling pathway
GO:0048132 P female germ-line stem cell asymmetric division
GO:0048749 P compound eye development
RNA-seq EntryA_BomoMSG_c23748_g1_i1
Sequence
(Amino Acid)
RDHCSDTGHIAEANRFEHLAVTVAQDLDVVAVAKSLGRGPPKFHYESRQFAVAQCNTDLN
ENELQLTVVRGIAYNVANPQDVDTYVRFEFPYPRRRRRRTARRW
*(34 a.a.)

- SilkBase 1999-2023 -