SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMSG1231_internal:A_BomoMSG_c5580_g2_i1
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		PREDICTED:_E3_ubiquitin-protein_ligase_UBR3_[Amyelois_transitella]
Ontology
GO:0000151 C ubiquitin ligase complex
GO:0001701 P in utero embryonic development
GO:0001967 P suckling behavior
GO:0004842 F ubiquitin-protein transferase activity
GO:0005737 C cytoplasm
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0007608 P sensory perception of smell
GO:0008270 F zinc ion binding
GO:0009790 P embryo development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0042048 P olfactory behavior
GO:0046872 F metal ion binding
GO:0061630 F ubiquitin protein ligase activity
GO:0071596 P ubiquitin-dependent protein catabolic process via the N-end rule pathway
RNA-seq EntryA_BomoMSG_c5580_g2_i1
Sequence
(Amino Acid)
YLAAFLCAAVRWMGVRAADVLPPAPLLALLAAHPLRVQSLFYEILAGVWVRNGLQIKGQA
MTYIQANFCNSMVDMDIYWLQICAAHLPPDQFMDMCIDMFGVREWLSMLPMSPVQAA
(38 a.a.)

- SilkBase 1999-2023 -