SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG1219_3prime_partial:A_BomoMSG_c5550_g1_i1
Scaffold_idBomo_Chr6
NCBI non-redundant
(nr)
CCR4-NOT_transcription_complex_subunit_6_isoform_X1_[Bombyx_mori]
Ontology
GO:0000289 P nuclear-transcribed mRNA poly(A) tail shortening
GO:0003723 F RNA binding
GO:0004518 F nuclease activity
GO:0004527 F exonuclease activity
GO:0004532 F exoribonuclease activity
GO:0004535 F poly(A)-specific ribonuclease activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006417 P regulation of translation
GO:0006977 P DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0008284 P positive regulation of cell population proliferation
GO:0010606 P positive regulation of cytoplasmic mRNA processing body assembly
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0030014 C CCR4-NOT complex
GO:0031047 P gene silencing by RNA
GO:0035195 P gene silencing by miRNA
GO:0043928 P exonucleolytic catabolism of deadenylated mRNA
GO:0046872 F metal ion binding
GO:0070966 P nuclear-transcribed mRNA catabolic process, no-go decay
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
GO:0090503 P RNA phosphodiester bond hydrolysis, exonucleolytic
GO:2000327 P obsolete positive regulation of nuclear receptor transcription coactivator activity
RNA-seq EntryA_BomoMSG_c5550_g1_i1
Sequence
(Amino Acid)
MSRNKDKHEGASGRTYHIMSEAERASGRRGGWTTLEVTGGVRALAPPLFQLTHLTALYLN
DNSLQRIPTDINQLVNLHTLDISNNKLRSLPVELGDLIQLRELHLHNNYLRALPYELGRL
FHLQLLGLQGNPLNKEMLSIYNDSNGTAKLITYMLDNLQGKFDS
(53 a.a.)

- SilkBase 1999-2023 -