SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG12130_3prime_partial:A_BomoMSG_c23640_g1_i2
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
sodium-independent_sulfate_anion_transporter_isoform_X3_[Bombyx_mori]
Ontology
GO:0005254 F chloride channel activity
GO:0005654 C nucleoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0008271 F secondary active sulfate transmembrane transporter activity
GO:0008272 P sulfate transport
GO:0008509 F anion transmembrane transporter activity
GO:0015106 F bicarbonate transmembrane transporter activity
GO:0015116 F sulfate transmembrane transporter activity
GO:0015301 F anion:anion antiporter activity
GO:0015701 P bicarbonate transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019531 F oxalate transmembrane transporter activity
GO:0019532 P oxalate transport
GO:0042391 P regulation of membrane potential
GO:0043231 C intracellular membrane-bounded organelle
GO:0051453 P regulation of intracellular pH
GO:0055085 P transmembrane transport
GO:0070062 C extracellular exosome
GO:1902358 P sulfate transmembrane transport
GO:1902476 P chloride transmembrane transport
RNA-seq EntryA_BomoMSG_c23640_g1_i2
Sequence
(Amino Acid)
MHKKGTMLYVILGTVKEVSIGPTSLMALFTLQICRELPIEFVVLLTFLSGCIVFVMGLLR
LGFLVDLISPSVTSGFTSATAIIIVAGQVKGLIGLSFVAESVADNVYFVVS
(36 a.a.)

- SilkBase 1999-2023 -