| Name | O_BomoMSG12056_internal:A_BomoMSG_c23602_g1_i4 |
| Scaffold_id | Bomo_Chr11 |
NCBI non-redundant (nr) | cyclin-dependent_kinase_14,_partial_[Bombyx_mori] |
| Ontology |
| GO:0000086 |
P |
G2/M transition of mitotic cell cycle |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000308 |
C |
cytoplasmic cyclin-dependent protein kinase holoenzyme complex |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0004693 |
F |
cyclin-dependent protein serine/threonine kinase activity |
| GO:0005524 |
F |
ATP binding |
| GO:0005634 |
C |
nucleus |
| GO:0005737 |
C |
cytoplasm |
| GO:0005886 |
C |
plasma membrane |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0007049 |
P |
cell cycle |
| GO:0016020 |
C |
membrane |
| GO:0016055 |
P |
Wnt signaling pathway |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0051301 |
P |
cell division |
| GO:0051726 |
P |
regulation of cell cycle |
| GO:0060828 |
P |
regulation of canonical Wnt signaling pathway |
|
| RNA-seq Entry | A_BomoMSG_c23602_g1_i4 |
Sequence (Amino Acid) | IGRASLRGLSYCHRRRVLHRDVKPQNLLISSQGELKLADFGLARAKSVPSHTYSHEVVTL
WYRPPDVLLGSTEYSTSLDIWGVGCIFVEMICGVPTFPGIRDTHDQLDKIFKVVGTPTEE
SWSGVSRLPGARVHLSR
(44 a.a.) |