| Name | O_BomoMSG12054_5prime_partial:A_BomoMSG_c23602_g1_i2 |
| Scaffold_id | Bomo_Chr11 |
NCBI non-redundant
(nr) | cyclin-dependent_kinase_14,_partial_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0004693 |
F |
cyclin-dependent protein serine/threonine kinase activity |
| GO:0005515 |
F |
protein binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005886 |
C |
plasma membrane |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0006887 |
P |
exocytosis |
| GO:0007283 |
P |
spermatogenesis |
| GO:0008021 |
C |
synaptic vesicle |
| GO:0015630 |
C |
microtubule cytoskeleton |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0030054 |
C |
cell junction |
| GO:0030133 |
C |
transport vesicle |
| GO:0030154 |
P |
cell differentiation |
| GO:0030252 |
P |
growth hormone secretion |
| GO:0031175 |
P |
neuron projection development |
| GO:0031234 |
C |
extrinsic component of cytoplasmic side of plasma membrane |
| GO:0031410 |
C |
cytoplasmic vesicle |
| GO:0043005 |
C |
neuron projection |
| GO:0045202 |
C |
synapse |
| GO:0051726 |
P |
regulation of cell cycle |
| GO:0061178 |
P |
regulation of insulin secretion involved in cellular response to glucose stimulus |
|
| RNA-seq Entry | A_BomoMSG_c23602_g1_i2 |
Sequence
(Amino Acid) | DRKSVGGNGEYRVRRQLSVSSDSKLLDEGAREEARVVMRPKRPPRPKSEAFLGPHEQSSR
RTKRFSAFGGDSPFGKSEAYIKLEQLGEGSYATVYKGYSN
*(32 a.a.) |
