SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMSG12033_complete:A_BomoMSG_c23584_g1_i1
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
SWI/SNF_complex_subunit_SMARCC2_isoform_X2_[Bombyx_mori]
Ontology
GO:0000790 C chromatin
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001741 C XY body
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006323 P DNA packaging
GO:0006337 P nucleosome disassembly
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007399 P nervous system development
GO:0008286 P insulin receptor signaling pathway
GO:0009887 P animal organ morphogenesis
GO:0016514 C SWI/SNF complex
GO:0016568 P chromatin organization
GO:0030850 P prostate gland development
GO:0031492 F nucleosomal DNA binding
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043044 P chromatin remodeling
GO:0043234 C protein-containing complex
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0047485 F protein N-terminus binding
GO:0071564 C npBAF complex
GO:0071565 C nBAF complex
GO:0090544 C SWI/SNF superfamily-type complex
RNA-seq EntryA_BomoMSG_c23584_g1_i1
Sequence
(Amino Acid)
MEAHVKAAGAHGAAAALAATGIAGTAPEPTGEKKEGGSEVKNEPMEVEESDAKVKEEPSE
QAPPEDKDAKDEPASPQPSEAPATVDAKLQSAASAALAAAAVKAKHLAGVEERKIKSLVA
LLVETQMKKLEIKLRHFEELEATMEREREGLEYQRQQLIQERQQFHLEQLKAAEFRSKHQ
AHQRLQAENAGLAAAANPEQPPPADAQPAPQPAHA
*(71 a.a.)

- SilkBase 1999-2023 -